Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA038608 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-GLS2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGG
VRHHLSEAAAQGRETPHSHQPQHQDHDSSESGMLS
RLGDLLFY- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage (1-2 days). Long time storage is recommended at -20°C. If stored at lower temperature, aliquot to avoid repeated freezing and thawing. Working dilution samples should be discarded if not used within 12 hours.
Submitted references Targeting hepatic glutaminase activity to ameliorate hyperglycemia
Targeting glutaminolysis has antileukemic activity in acute myeloid leukemia and synergizes with BCL-2 inhibition
Targeted inhibition of tumor-specific glutaminase diminishes cell-autonomous tumorigenesis
Compensatory glutamine metabolism promotes glioblastoma resistance to mTOR inhibitor treatment
Miller R, Shi Y, Lu W, Pirman D, Jatkar A, Blatnik M, Wu H, Cárdenas C, Wan M, Foskett J, Park J, Zhang Y, Holland W, Rabinowitz J, Birnbaum M
Nature Medicine 2018;24(4):518-524
Nature Medicine 2018;24(4):518-524
Targeting glutaminolysis has antileukemic activity in acute myeloid leukemia and synergizes with BCL-2 inhibition
Jacque N, Ronchetti A, Larrue C, Meunier G, Birsen R, Willems L, Saland E, Decroocq J, Maciel T, Lambert M, Poulain L, Hospital M, Sujobert P, Joseph L, Chapuis N, Lacombe C, Moura I, Demo S, Sarry J, Recher C, Mayeux P, Tamburini J, Bouscary D
Blood 2015;126(11):1346-1356
Blood 2015;126(11):1346-1356
Targeted inhibition of tumor-specific glutaminase diminishes cell-autonomous tumorigenesis
Xiang Y, Stine Z, Xia J, Lu Y, O’Connor R, Altman B, Hsieh A, Gouw A, Thomas A, Gao P, Sun L, Song L, Yan B, Slusher B, Zhuo J, Ooi L, Lee C, Mancuso A, McCallion A, Le A, Milone M, Rayport S, Felsher D, Dang C
Journal of Clinical Investigation 2015;125(6):2293-2306
Journal of Clinical Investigation 2015;125(6):2293-2306
Compensatory glutamine metabolism promotes glioblastoma resistance to mTOR inhibitor treatment
Tanaka K, Sasayama T, Irino Y, Takata K, Nagashima H, Satoh N, Kyotani K, Mizowaki T, Imahori T, Ejima Y, Masui K, Gini B, Yang H, Hosoda K, Sasaki R, Mischel P, Kohmura E
Journal of Clinical Investigation 2015;125(4):1591-1602
Journal of Clinical Investigation 2015;125(4):1591-1602
No comments: Submit comment
No validations: Submit validation data