HPA041218

ADCY7 antibody from Atlas Antibodies
AC7, KIAA0037

Antibody data

Product number
HPA041218
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041218, RRID:AB_2677365
Product name
Anti-ADCY7
Provider product page
Atlas Antibodies - HPA041218
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTP
DRSMSPKGRSEDDSYDDEMLSAIEGLSSTRPCCSK
SDDFYTFGSIFL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -