HPA019900

SH3GLB1 antibody from Atlas Antibodies
Bif-1, CGI-61, KIAA0491, PPP1R70
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019900
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019900, RRID:AB_1845356
Product name
Anti-SH3GLB1
Provider product page
Atlas Antibodies - HPA019900
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
THAHHLRCLNDFVEAQMTYYAQCYQYMLDLQKQLG
SFPSNYLSNNNQTSVTPVPSVLPNAIGSSAMASTS
GLVITSPSNLSDLKECSGSRKARVLYDYDAANSTE
LSLLADEVITVFSVVGMDSD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -