HPA015608

SH3GLB1 antibody from Sigma-Aldrich
Bif-1, CGI-61, KIAA0491, PPP1R70
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015608
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015608, RRID:AB_1845355
Product name
Anti-SH3GLB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015608
Antibody type
Polyclonal
Antigen
Endophilin-B1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DRKAPSRINNPELLGQYMIDAGTEFGPGTAYGNAL
IKCGETQKRIGTADRELIQTSALNFLTPLRNFIEG
DYKTIAKER
Storage
-20C
Provider Type Product Number
- No reagents -