HPA017959

PALMD antibody from Sigma-Aldrich
C1orf11, FLJ20271, PALML
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017959
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017959, RRID:AB_1854949
Product name
Anti-PALMD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017959
Antibody type
Polyclonal
Antigen
Palmdelphin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDDGQKSVYAVSSNHSAAYNGTDGLAPVEVEELLR
QASERNSKSPTEYHEPVYANPFYRPTTPQRETVTP
GPNFQERIKIKTNGLGIGVNESIHNMGNGLSEERG
NNFNHISPIPPVPHPRSVIQQAEEKLHTP
Storage
-20C
Provider Type Product Number
- No reagents -