SAB1401703

TAF9B antibody from MilliporeSigma / Merck KGaA
DN-7, DN7, TAF9L, TAFII31L, TFIID-31
No application information provided.

Antibody data

Product number
SAB1401703
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-TAF9B antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB1401703
Antibody type
Polyclonal
Antigen
TAF9B (NP_057059.2, 1 a.a. ~ 450 a.a) full-length human protein.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRV
INQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADD
VRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLP
LIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQG
RLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATP
MSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLIN
PSMIGPKNILITTNMVSSQNTANEANPLKRKHEDD
DDNDIM
Storage
-20C