HPA017857

LPIN2 antibody from Sigma-Aldrich
KIAA0249
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017857
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017857, RRID:AB_1852904
Product name
Anti-LPIN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017857
Antibody type
Polyclonal
Antigen
Lipin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STKVSKRERSDHHPRTATITPSENTHFRVIPSEDN
LISEVEKDASMEDTVCTIVKPKPRALGTQMSDPTS
VAELLEPPLESTQISSMLDADHLPNAALAEAPSES
KPAAKVDSPSKKKGVHKRSQHQGPD
Storage
-20C
Provider Type Product Number
- No reagents -