HPA062497

DAGLA antibody from Atlas Antibodies
C11orf11, DAGLALPHA, KIAA0659, NSDDR
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA062497
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA062497, RRID:AB_2684784
Product name
Anti-DAGLA
Provider product page
Atlas Antibodies - HPA062497
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVM
EGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPE
LIFQQQPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -