H00219790-B01

RTKN2 antibody from Abnova Corporation
bA531F24.1, Em:AC024597.2, FLJ39352, PLEKHK1

Antibody data

Product number
H00219790-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00219790-B01, RRID:AB_1138802
Product name
PLEKHK1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00219790-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PLEKHK1 protein.
Antigen sequence
MEGPSLRGPALRLAGLPTQQDCNIQEKIDLEIRMR
EGIWKLLSLSTQKDQVLHAVKNLMVCNARLMAYTS
ELQKLEEQIANQTGRCDVKFESKERTACKGKIAIS
DIRIPLMWKDSDHFSNKERSRRYAIFCLFKMGANV
FDTDVVNVDKTITDICFENVTIL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -