Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404739 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-All-Trans Retinoic Acid-Induced Differentiation Factor (ATRAID) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-C2orf28 antibody: synthetic peptide directed towards the C terminal of human C2orf28
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus
- Host
- Rabbit
- Antigen sequence
VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSI
LLWAT QRRKAKTS- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of the distinct promoters for the two transcripts of apoptosis related protein 3 and their transcriptional regulation by NFAT and NFkappaB.
Yang G, Yu F, Fu H, Lu F, Huang B, Bai L, Zhao Z, Yao L, Lu Z
Molecular and cellular biochemistry 2007 Aug;302(1-2):187-94
Molecular and cellular biochemistry 2007 Aug;302(1-2):187-94
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting