Antibody data

Product number
H00022891-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022891-M03, RRID:AB_1582095
Product name
ZNF365 monoclonal antibody (M03), clone 2E3
Provider product page
Abnova Corporation - H00022891-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF365.
Antigen sequence
GLPTSDTKASFEAHVREKFNRMVEAVDRTIEKRID
KLTKELAQKTAELLEVRAAFVQLTQKKQEVQRRER
ALN
Isotype
IgG
Antibody clone number
2E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -