HPA016882

TTLL8 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016882
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016882, RRID:AB_10603223
Product name
Anti-TTLL8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016882
Antibody type
Polyclonal
Antigen
tubulin tyrosine ligase-like family, member 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLEIGLCVNMRSLPWYVPANPDSFFPRCYSLCTES
EQQEFLEDFRRTMASSILKWVVSHQSCSRSSRSKP
RDQREEAGSSDLSSRQDAENAEAKLRGLPGQLVDI
ACKVCQAYLGQLEHEDIDTSADAVEDLTEAEWEDL
TQQYYSLVHGDAFISNSRNYFSQCQALLNRITSVN
PQTDIDGLRNIWII
Storage
-20C
Provider Type Product Number
- No reagents -