Antibody data

Product number
H00113146-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00113146-M03, RRID:AB_1204022
Product name
AHNAK2 monoclonal antibody (M03), clone 4G9
Provider product page
Abnova Corporation - H00113146-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AHNAK2.
Antigen sequence
ELPKKQEKAGWFRFPKLGFSSSPTKKSKSTEDGAE
LEEQKLQEETITFFDARESFSPEEKEEGELIGPVG
TGLDSRVMVTSAARTELILPEQDRKADDESKGSGL
GPNEG
Isotype
IgG
Antibody clone number
4G9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -