HPA002940

AHNAK2 antibody from Atlas Antibodies
C14orf78
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA002940
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA002940, RRID:AB_1859547
Product name
Anti-AHNAK2
Provider product page
Atlas Antibodies - HPA002940
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DAKDSKFKMPKFKMPSFRVSAPGESIEALVDVSEL
KVEADMSLPSMQGDLKTTDISIQPPSAQLEVQAGQ
VDVKLPEGHVPEGAGLKGHLPKLQMPSFKMPEVDL
KG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -