HPA005782

BAZ2A antibody from Sigma-Aldrich
KIAA0314, TIP5, WALp3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005782
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005782, RRID:AB_10601089
Product name
Anti-BAZ2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005782
Antibody type
Polyclonal
Antigen
bromodomain adjacent to zinc finger domain, 2A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYPSANPGSNLKDPPLLSQFSGGQYPLNGILGGSR
QPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQE
LYDSFPDQNFEVMPNGPPSFFTSPQTSPMLGSSIQ
TFAPSQEVGSGIHPDEAAEKEMTSVVAENGTGLVG
SLELEEEQPELKMCGYNGSVPSVESLHQEVSVLVP
Storage
-20C
Provider Type Product Number
- No reagents -