HPA035810

TRIM60 antibody from MilliporeSigma / Merck KGaA
FLJ35882, RNF129, RNF33
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA035810
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA035810, RRID:AB_10601827
Product name
Anti-TRIM60 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA035810
Antibody type
Polyclonal
Antigen
tripartite motif-containing 60 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SYHREILEGSLEPLRNNIERVEKVIILQGSKSVEL
KKKVEYKREEINSEFEQIRLFLQNEQEMILRQIQD
EEMNILAKLNENLVELSDYVSTL
Storage
-20C
Provider Type Product Number
- No reagents -