PAB20647

SYDE1 antibody from Abnova Corporation
7h3, FLJ13511

Antibody data

Product number
PAB20647
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20647, RRID:AB_10965263
Product name
SYDE1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20647
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SYDE1.
Antigen sequence
GDWSVCGRDFLPCGRDFLSGPDYDHVTGSDSEDED
EEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALILD
LERELSKQINV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -