HPA013328

SYDE1 antibody from Sigma-Aldrich
7h3, FLJ13511
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013328
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013328, RRID:AB_1848705
Product name
Anti-SYDE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013328
Antibody type
Polyclonal
Antigen
Rho GTPase-activating protein SYDE1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GDWSVCGRDFLPCGRDFLSGPDYDHVTGSDSEDED
EEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALILD
LERELSKQINV
Storage
-20C
Provider Type Product Number
- No reagents -