HPA013328

SYDE1 antibody from Atlas Antibodies
7h3, FLJ13511, SYD1

Antibody data

Product number
HPA013328
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013328, RRID:AB_1848705
Product name
Anti-SYDE1
Provider product page
Atlas Antibodies - HPA013328
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GDWSVCGRDFLPCGRDFLSGPDYDHVTGSDSEDED
EEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALILD
LERELSKQINV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.