Antibody data

Product number
H00124460-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00124460-B01P, RRID:AB_1580746
Product name
SLIC1 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00124460-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SLIC1 protein.
Antigen sequence
MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLP
HPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCR
WKHVKLLFEIASARIEERKVSKFVMGKSRPGEMTY
PGSRGETGTAPEPDPRCPRQSDML
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -