HPA002943

CECR2 antibody from Sigma-Aldrich
KIAA1740
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002943
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002943, RRID:AB_1078496
Product name
Anti-CECR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002943
Antibody type
Polyclonal
Antigen
Cat eye syndrome critical region protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLGHVMDSRVMRPPVPPNQWTEQSGFLPHGVPSSG
YMRPPCKSAGHRLQPPPVPAPSSLFGAPAQALRGV
QGGDSMMDSPEMIAMQQLSSRVCPPGVPYHPHQPA
HPRLPGPFPQVAHPMSVTVSAPKPALGNPGRAPEN
SEAQEP
Storage
-20C
Provider Type Product Number
- No reagents -