Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA058548 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA058548, RRID:AB_2683751
- Product name
- Anti-MAF1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QTSGLSPSRLSKSQGGEEEGPLSDKCSRKTLFYLI
ATLNESFRPDYDFSTARSHEFSREPSLSWVVNAVN
CSLF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Involvement of MAF1 homolog, negative regulator of RNA polymerase III in colorectal cancer progression.
Hokonohara K, Nishida N, Miyoshi N, Takahashi H, Haraguchi N, Hata T, Matsuda C, Mizushima T, Doki Y, Mori M
International journal of oncology 2019 Mar;54(3):1001-1009
International journal of oncology 2019 Mar;54(3):1001-1009
No comments: Submit comment
No validations: Submit validation data