Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055033-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055033-B01P, RRID:AB_1573547
- Product name
- FKBP14 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human FKBP14 protein.
- Antigen sequence
MRLFLWNAVLTLFVTSLIGALIPEPEVKIEVLQKP
FICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHN
NGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLII
PPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRS
HESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVV
NESHHDALVEDIFDKEDEDKDGFISAREFTYKHDE
L- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mutations in FKBP14 cause a variant of Ehlers-Danlos syndrome with progressive kyphoscoliosis, myopathy, and hearing loss.
Baumann M, Giunta C, Krabichler B, Rüschendorf F, Zoppi N, Colombi M, Bittner RE, Quijano-Roy S, Muntoni F, Cirak S, Schreiber G, Zou Y, Hu Y, Romero NB, Carlier RY, Amberger A, Deutschmann A, Straub V, Rohrbach M, Steinmann B, Rostásy K, Karall D, Bönnemann CG, Zschocke J, Fauth C
American journal of human genetics 2012 Feb 10;90(2):201-16
American journal of human genetics 2012 Feb 10;90(2):201-16
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FKBP14 expression in transfected 293T cell line (H00055033-T01) by FKBP14 MaxPab polyclonal antibody.Lane 1: FKBP14 transfected lysate(23.21 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FKBP14 MaxPab polyclonal antibody. Western Blot analysis of FKBP14 expression in human kidney.