HPA013329

FKBP14 antibody from Sigma-Aldrich
FKBP22, FLJ20731
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013329
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013329, RRID:AB_1848613
Product name
Anti-FKBP14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013329
Antibody type
Polyclonal
Antigen
FK506-binding protein 14 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEI
RNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFE
KHGAVVNESHHDALVE
Storage
-20C
Provider Type Product Number
- No reagents -