HPA013329

FKBP14 antibody from Atlas Antibodies
FKBP22, FLJ20731
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013329
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013329, RRID:AB_1234316
Product name
Anti-FKBP14
Provider product page
Atlas Antibodies - HPA013329
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEI
RNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFE
KHGAVVNESHHDALVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -