HPA013329

FKBP14 antibody from Atlas Antibodies
FKBP22, FLJ20731
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013329
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013329, RRID:AB_1848613
Product name
Anti-FKBP14
Provider product page
Atlas Antibodies - HPA013329
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEI
RNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFE
KHGAVVNESHHDALVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -