HPA041557

antibody from Atlas Antibodies

Targeting: SUGP2 KIAA0365, SFRS14

Antibody data

Submit

Validation data

Product number: HPA041557 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA041557, RRID:AB_10794301
Product name: Anti-SUGP2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: DQLVKRVIEGSLSPKERTLLKEDPAYWFLSDENSL EYKYYKLKLAEMQRMSENLRGADQKPTSADCAVRA MLYSRAVRNLKKKLL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SUGP2 protein structure - HPA041557 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using Anti-SUGP2 antibody. Corresponding SUGP2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, lymph node and testis using Anti-SUGP2 antibody HPA041557 (A) shows similar protein distribution across tissues to independent antibody HPA061111 (B).
Antibody #2 product nr: HPA061111
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-SUGP2 antibody HPA041557.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SUGP2 antibody HPA041557.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SUGP2 antibody HPA041557.
Sample type: HUMAN