H00010147-D01

SUGP2 antibody from Abnova Corporation
KIAA0365, SFRS14

Antibody data

Product number
H00010147-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010147-D01, RRID:AB_10904884
Product name
SFRS14 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00010147-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human SFRS14 protein.
Antigen sequence
MYDDVHSDGRYSLSGSVAHSRDAGREGLRSDVFPG
PSFRSSNPSISDDSYFRKECGRDLEFSHSDSRDQV
IGHRKLGHFRSQDWKFALRGSWEQDFGHPVSQESS
WSQEYSFGPSAVLGDFGSSRLIEKECLEKESRDYD
VDHPGEADSVLRGSSQVQARGRALNIVDQEGSLLG
KGETQGLLTAKGGVGKLVTLRNVSTKKIPTVNRIT
PKTQGTNQIQKNTPSPDVTLGTNPGTEDIQFPIQK
IPLGLDLKNLRLPRRKMSFDIIDKSDVFSRFGIEI
IKWAGFHTIKDDIKFSQLFQTLFELETETCAKMLA
SFKCSLKPEHRDFCFFTIKFLKHSALKTPRVDNEF
LNMLLDKGAVKTKNCFFEIIKPFDKYIMRLQDRLL
KSVTPLLMACNAYELSVKMKTLSNPLDLALALETT
NSLCRKSLALLGQTFSLASSFRQEKILEAVGLQDI
APSPAAFPNFEDSTLFGREYIDHLKAWLVSSGCPL
QVKKAEPEPMREEEKMIPPTKPEIQAKAPSSLSDA
VPQRADHRVVGTIDQLVKRVIEGSLSPKERTLLKE
DPAYWFLSDENSLEYKYYKLKLAEMQRMSENLRGA
DQKPTSADCAVRAMLYSRAVRNLKKKLLPWQRRGL
LRAQGLRGWKARRATTGTQTLLSSGTRLKHHGRQA
PGLSQAKPSLPDRNDAAKDCPPDPVGPSPQDPSLE
ASGPSPKPAGVDISEAPQTSSPCPSADIDMKTMET
AEKLARFVAQVGPEIEQFSIENSTDNPDLWFLHDQ
NSSAFKFYRKKVFELCPSICFTSSPHNLHTGGGDT
TGSQESPVDLMEGEAEFEDEPPPREAELESPEASS
GTCFPRKRISSKSLKVGMIPAPKRVCLIQEPKVHE
PVRIAYDRPRGRPMSKKKKPKDLDFAQQKLTDKNL
GFQMLQKMGWKEGHGLGSLGKGIREPVSVYAAGSL
GWEWVGPQSFHLQPAAWLLHSQDGLQLAVDFCFLN
RRHLQMRS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -