HPA013589

GIMAP2 antibody from Sigma-Aldrich
DKFZp586D0824, HIMAP2, IAN12, IMAP2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013589
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013589, RRID:AB_1849666
Product name
Anti-GIMAP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013589
Antibody type
Polyclonal
Antigen
GTPase IMAP family member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLME
KNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSL
IKYMETQRSYTA
Storage
-20C
Provider Type Product Number
- No reagents -