HPA028973

ZNF484 antibody from MilliporeSigma / Merck KGaA
BA526D8.4, FLJ33884
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028973
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028973, RRID:AB_10610703
Product name
Anti-ZNF484 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028973
Antibody type
Polyclonal
Antigen
zinc finger protein 484 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQEEPCMLDGEIPSQSRPDGDIGFGPLQQRMSEEV
SFQSEININLFTRDDPYSILEELWKDDEHTRKCGE
NQNKPLSRVVFINKKTLANDSIFEYKDIGEIVHVN
THLVSSRKRPHNCNSCGKNLEPIITLYNRNNATEN
SDKTIG
Storage
-20C
Provider Type Product Number
- No reagents -