HPA051005

antibody from Atlas Antibodies

Targeting: PNMT PENT

Antibody data

Submit

Validation data

Product number: HPA051005 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA051005, RRID:AB_2681306
Product name: Anti-PNMT
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GHLLLIGALEESWYLAGEARLTVVPVSEEEVREAL VRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQ KV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

PNMT protein structure - HPA051005 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-PNMT antibody. Corresponding PNMT RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, cerebral cortex, colon and liver using Anti-PNMT antibody HPA051005 (A) shows similar protein distribution across tissues to independent antibody HPA043412 (B).
Antibody #2 product nr: HPA043412
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows cytoplasmic positivity in medullary cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-PNMT antibody HPA051005.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-PNMT antibody HPA051005.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver using Anti-PNMT antibody HPA051005.
Sample type: HUMAN