Antibody data

Product number
H00093436-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00093436-M03, RRID:AB_1237647
Product name
ARMC6 monoclonal antibody (M03), clone 2H8
Provider product page
Abnova Corporation - H00093436-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ARMC6.
Antigen sequence
MVSKRIAQETFDAAVRENIEEFAMGPEEAVKEAVE
QFESQGVDLSNIVKTAPKVSADGSQEPTHDILQML
SDLQESVASSRPQEVSAYLTRFCDQCKQDKACRFL
AAQKGAYPIIFTAWKLATAGDQGLLLQSLNALSVL
TDGQPDLLDAQGLQLLVATLTQNADEADLTCSGIR
CVRHACLKHEQNRQDLVKAGVLPLLTGAITHHGHH
TDVVREACWALRVMTFDDDIRVPFGHAHNHAKMIV
QENKGLKVLIEATKAFLDNPGILSELCGTLSRLAI
RNEFCQEVVDLGGLSILVSLLADCNDHQMRDQSGV
QELVKQVLSTLRAIAGNDDVKDAIVRAGGTESIVA
AMTQHLTSPQVCEQSCAALCFLALRKPDNSRIIVE
GGGAVAALQAMKAHPQKAGVQKQACMLIRNLVAHG
QAFSKPILDLGAEALIMQARSAHRDCEDVAKAALR
DLGCHVELRELWTGQRGNLAP
Isotype
IgG
Antibody clone number
2H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -