Antibody data

Product number
H00083698-M29
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083698-M29, RRID:AB_1571997
Product name
CALN1 monoclonal antibody (M29), clone 2G5
Provider product page
Abnova Corporation - H00083698-M29
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CALN1.
Antigen sequence
EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGY
MPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKL
V
Isotype
IgG
Antibody clone number
2G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -