PAB15693

PALD1 antibody from Abnova Corporation
KIAA1274, PALD
No application information provided.

Antibody data

Product number
PAB15693
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB15693, RRID:AB_10679877
Product name
X99384 polyclonal antibody
Provider product page
Abnova Corporation - PAB15693
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against partial recombinant X99384.
Antigen sequence
QLLPDGHHVKKEVDAALDIVSETMTPMHYHLREII
ISTYRQAKATKEAQEAQRLQLRSLQYLERYIYLIL
FNAYLRLEKTSSWQRPFSTWMREVATKAGIYEILN
QLGFPELESIEEQPLSRLRYRWQEQSRDPEPCDVG
DFL
Storage
Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -