HPA017343

PALD1 antibody from Sigma-Aldrich
KIAA1274, PALD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017343
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017343, RRID:AB_1852397
Product name
Anti-KIAA1274 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017343
Antibody type
Polyclonal
Antigen
Paladin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GEFQVVMKVVQLLPDGHRVKKEVDAALDTVSETMT
PMHYHLREIIICTYRQAKAAKEAQEMRRLQLRSLQ
YLERYVCLILFNAYLHLEKADSWQRPFSTWMQ
Storage
-20C
Provider Type Product Number
- No reagents -