H00029093-B01

MRPL22 antibody from Abnova Corporation
HSPC158, MRP-L25, RPML25

Antibody data

Product number
H00029093-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00029093-B01, RRID:AB_913690
Product name
MRPL22 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00029093-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MRPL22 protein.
Antigen sequence
MAAAVLGQLGALWIHNLRSRGKLALGVLPQSYIHT
SASLDISRKWEKKNKIVYPPQLPGEPRRPAEIYHC
RRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDK
KGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAEST
SGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEG
PPPPPEPPKTAVAHAKECIQQLRSRTIVHTL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -