HPA017962

MAP3K8 antibody from Atlas Antibodies
c-COT, COT, EST, ESTF, MEKK8, Tpl-2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017962
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017962, RRID:AB_1853776
Product name
Anti-MAP3K8
Provider product page
Atlas Antibodies - HPA017962
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLL
SGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYG
QRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLT
YRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIP
VDQFKPSDV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -