H00004814-M01A

NINJ1 antibody from Abnova Corporation
NIN1
No application information provided.

Antibody data

Product number
H00004814-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004814-M01A, RRID:AB_1578045
Product name
NINJ1 monoclonal antibody (M01A), clone 2G5
Provider product page
Abnova Corporation - H00004814-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NINJ1.
Antigen sequence
MDSGTEEYELNGGLPPGTPGSPDASPARWGWRHGP
INVNHYASKKSAAESMLDIALLMANASQLKA
Isotype
IgM
Antibody clone number
2G5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -