H00084299-B01P

MIEN1 antibody from Abnova Corporation
C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4

Antibody data

Product number
H00084299-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084299-B01P, RRID:AB_1204024
Product name
C17orf37 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00084299-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C17orf37 protein.
Antigen sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGF
EATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN
GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKI
TNSRPPCVIL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -