H00084299-B01P
antibody from Abnova Corporation
Targeting: MIEN1
C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084299-B01P - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084299-B01P, RRID:AB_1204024
- Product name
- C17orf37 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human C17orf37 protein.
- Antigen sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGF
EATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN
GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKI
TNSRPPCVIL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1.
Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells.
Rajendiran S, Parwani AV, Hare RJ, Dasgupta S, Roby RK, Vishwanatha JK
Molecular cancer 2014 Nov 19;13:250
Molecular cancer 2014 Nov 19;13:250
Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells.
Dasgupta S, Wasson LM, Rauniyar N, Prokai L, Borejdo J, Vishwanatha JK
Oncogene 2009 Aug 13;28(32):2860-72
Oncogene 2009 Aug 13;28(32):2860-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of C17orf37 expression in transfected 293T cell line (H00084299-T01) by C17orf37 MaxPab polyclonal antibody.Lane 1: C17orf37 transfected lysate(12.65 KDa).Lane 2: Non-transfected lysate.