H00084299-B01
antibody from Abnova Corporation
Targeting: MIEN1
C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084299-B01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084299-B01, RRID:AB_1673418
- Product name
- C17orf37 MaxPab mouse polyclonal antibody (B01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human C17orf37 protein.
- Antigen sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGF
EATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN
GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKI
TNSRPPCVIL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Prenylated c17orf37 induces filopodia formation to promote cell migration and metastasis.
Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells.
Dasgupta S, Cushman I, Kpetemey M, Casey PJ, Vishwanatha JK
The Journal of biological chemistry 2011 Jul 22;286(29):25935-46
The Journal of biological chemistry 2011 Jul 22;286(29):25935-46
Novel gene C17orf37 in 17q12 amplicon promotes migration and invasion of prostate cancer cells.
Dasgupta S, Wasson LM, Rauniyar N, Prokai L, Borejdo J, Vishwanatha JK
Oncogene 2009 Aug 13;28(32):2860-72
Oncogene 2009 Aug 13;28(32):2860-72
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of C17orf37 expression in transfected 293T cell line (H00084299-T01) by C17orf37 MaxPab polyclonal antibody.Lane 1: C17orf37 transfected lysate(12.65 KDa).Lane 2: Non-transfected lysate.