H00084299-M02
antibody from Abnova Corporation
Targeting: MIEN1
C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084299-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084299-M02, RRID:AB_10615760
- Product name
- C17orf37 monoclonal antibody (M02), clone 3B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant C17orf37.
- Antigen sequence
MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGF
EATYLELASAVKEQYPGIEIESRLGGTGAFEIEIN
GQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKI
TNSRPPCVIL- Isotype
- IgG
- Antibody clone number
- 3B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references MicroRNA-940 suppresses prostate cancer migration and invasion by regulating MIEN1.
Prenylated c17orf37 induces filopodia formation to promote cell migration and metastasis.
Rajendiran S, Parwani AV, Hare RJ, Dasgupta S, Roby RK, Vishwanatha JK
Molecular cancer 2014 Nov 19;13:250
Molecular cancer 2014 Nov 19;13:250
Prenylated c17orf37 induces filopodia formation to promote cell migration and metastasis.
Dasgupta S, Cushman I, Kpetemey M, Casey PJ, Vishwanatha JK
The Journal of biological chemistry 2011 Jul 22;286(29):25935-46
The Journal of biological chemistry 2011 Jul 22;286(29):25935-46
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of C17orf37 expression in transfected 293T cell line by C17orf37 monoclonal antibody (M02), clone 3B5.Lane 1: C17orf37 transfected lysate(12.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged C17orf37 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol