HPAB-0013CQ
antibody from Creative Biolabs
Targeting: MIEN1
C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPAB-0013CQ - Provider product page
- Provider
- Creative Biolabs
- Product name
- Human Anti-MIEN1 Recombinant Antibody (clone MAb163)
- Antibody type
- Monoclonal
- Description
- MAb 163 recognizes an epitope within amino acid residues 48 to 87 of C35, with the amino acid positions numbered relative to the amino terminal methionine of the native human sequence. The epitope recognized by the monoclonal antibody to C35 is mapped to amino acid residues (EQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEK).
- Reactivity
- Human
- Host
- Human
- Antibody clone number
- MAb163
- Storage
- Centrifuge briefly prior to opening vial. Store at +4¡ãC short term (1-2 weeks). Aliquot and store at -20¡ãC long term. Avoid repeated freeze/thaw cycles.
No comments: Submit comment
No validations: Submit validation data