Antibody data
- Antibody Data
- Antigen structure
- References [10]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001434-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001434-M08, RRID:AB_463992
- Product name
- CSE1L monoclonal antibody (M08), clone 3D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CSE1L.
- Antigen sequence
LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQL
AFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPG
RVPSMVSTSLNAEALQYLQGYLQAARVTLL- Isotype
- IgG
- Antibody clone number
- 3D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references hCAS/CSE1L regulates RAD51 distribution and focus formation for homologous recombinational repair.
CSE1L Links cAMP/PKA and Ras/ERK pathways and regulates the expressions and phosphorylations of ERK1/2, CREB, and MITF in melanoma cells.
Early decline in serum phospho-CSE1L levels in vemurafenib/sunitinib-treated melanoma and sorafenib/lapatinib-treated colorectal tumor xenografts.
CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression.
MIR-137 suppresses growth and invasion, is downregulated in oligodendroglial tumors and targets CSE1L.
The prognostic significance of nuclear CSE1L in urinary bladder urothelial carcinomas.
Differential distributions of CSE1L/CAS and E-cadherin in the polarized and non-polarized epithelial glands of neoplastic colorectal epithelium.
Serum cellular apoptosis susceptibility protein is a potential prognostic marker for metastatic colorectal cancer.
Higher prevalence of secretory CSE1L/CAS in sera of patients with metastatic cancer.
Function of CSE1L/CAS in the secretion of HT-29 human colorectal cells and its expression in human colon.
Okimoto S, Sun J, Fukuto A, Horikoshi Y, Matsuda S, Matsuda T, Ikura M, Ikura T, Machida S, Kurumizaka H, Miyamoto Y, Oka M, Yoneda Y, Kiuchi Y, Tashiro S
Genes to cells : devoted to molecular & cellular mechanisms 2015 Sep;20(9):681-94
Genes to cells : devoted to molecular & cellular mechanisms 2015 Sep;20(9):681-94
CSE1L Links cAMP/PKA and Ras/ERK pathways and regulates the expressions and phosphorylations of ERK1/2, CREB, and MITF in melanoma cells.
Lee WR, Shen SC, Wu PR, Chou CL, Shih YH, Yeh CM, Yeh KT, Jiang MC
Molecular carcinogenesis 2015 Sep 1;
Molecular carcinogenesis 2015 Sep 1;
Early decline in serum phospho-CSE1L levels in vemurafenib/sunitinib-treated melanoma and sorafenib/lapatinib-treated colorectal tumor xenografts.
Lee WR, Shen SC, Shih YH, Chou CL, Tseng JT, Chin SY, Liu KH, Chen YC, Jiang MC
Journal of translational medicine 2015 Jun 13;13:191
Journal of translational medicine 2015 Jun 13;13:191
CSE1L modulates Ras-induced cancer cell invasion: correlation of K-Ras mutation and CSE1L expression in colorectal cancer progression.
Jiang MC, Yeh CM, Tai CJ, Chen HC, Lin SH, Su TC, Shen SC, Lee WR, Liao CF, Li LT, Lee CH, Chen YC, Yeh KT, Chang CC
American journal of surgery 2013 Sep;206(3):418-27
American journal of surgery 2013 Sep;206(3):418-27
MIR-137 suppresses growth and invasion, is downregulated in oligodendroglial tumors and targets CSE1L.
Li KK, Yang L, Pang JC, Chan AK, Zhou L, Mao Y, Wang Y, Lau KM, Poon WS, Shi Z, Ng HK
Brain pathology (Zurich, Switzerland) 2013 Jul;23(4):426-39
Brain pathology (Zurich, Switzerland) 2013 Jul;23(4):426-39
The prognostic significance of nuclear CSE1L in urinary bladder urothelial carcinomas.
Chang CC, Tai CJ, Su TC, Shen KH, Lin SH, Yeh CM, Yeh KT, Lin YM, Jiang MC
Annals of diagnostic pathology 2012 Oct;16(5):362-8
Annals of diagnostic pathology 2012 Oct;16(5):362-8
Differential distributions of CSE1L/CAS and E-cadherin in the polarized and non-polarized epithelial glands of neoplastic colorectal epithelium.
Uen WC, Tai CJ, Shen SC, Lee WR, Tsao TY, Deng WP, Chiou HY, Hsu CH, Hsieh CI, Liao CF, Jiang MC
Journal of molecular histology 2010 Oct;41(4-5):259-66
Journal of molecular histology 2010 Oct;41(4-5):259-66
Serum cellular apoptosis susceptibility protein is a potential prognostic marker for metastatic colorectal cancer.
Stella Tsai CS, Chen HC, Tung JN, Tsou SS, Tsao TY, Liao CF, Chen YC, Yeh CY, Yeh KT, Jiang MC
The American journal of pathology 2010 Apr;176(4):1619-28
The American journal of pathology 2010 Apr;176(4):1619-28
Higher prevalence of secretory CSE1L/CAS in sera of patients with metastatic cancer.
Tung MC, Tsai CS, Tung JN, Tsao TY, Chen HC, Yeh KT, Liao CF, Jiang MC
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2009 May;18(5):1570-7
Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology 2009 May;18(5):1570-7
Function of CSE1L/CAS in the secretion of HT-29 human colorectal cells and its expression in human colon.
Tsao TY, Tsai CS, Tung JN, Chen SL, Yue CH, Liao CF, Wang CC, Jiang MC
Molecular and cellular biochemistry 2009 Jul;327(1-2):163-70
Molecular and cellular biochemistry 2009 Jul;327(1-2):163-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CSE1L monoclonal antibody (M08), clone 3D8 Western Blot analysis of CSE1L expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CSE1L is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CSE1L on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CSE1L on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol