Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310312 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-CTD Small Phosphatase-Like Protein (CTDSPL) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CTDSPL antibody: synthetic peptide directed towards the N terminal of human CTDSPL
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
CCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAK
YLLPE VTVLDYGKKC- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references RBSP3 (HYA22) is a tumor suppressor gene implicated in major epithelial malignancies.
Kashuba VI, Li J, Wang F, Senchenko VN, Protopopov A, Malyukova A, Kutsenko AS, Kadyrova E, Zabarovska VI, Muravenko OV, Zelenin AV, Kisselev LL, Kuzmin I, Minna JD, Winberg G, Ernberg I, Braga E, Lerman MI, Klein G, Zabarovsky ER
Proceedings of the National Academy of Sciences of the United States of America 2004 Apr 6;101(14):4906-11
Proceedings of the National Academy of Sciences of the United States of America 2004 Apr 6;101(14):4906-11
No comments: Submit comment
No validations: Submit validation data