HPA013333

TNFAIP1 antibody from Sigma-Aldrich
B12, B61, BTBD34, EDP1, MGC2317
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013333
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013333, RRID:AB_1858160
Product name
Anti-TNFAIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013333
Antibody type
Polyclonal
Antigen
BTB/POZ domain-containing protein TNFAIP1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FGTILNYLRDDTITLPQNRQEIKELMAEAKYYLIQ
GLVNMCQSALQDKKDSYQPVCNIPIITSLKEEERL
IESSTKPVVKLLYNRSNNKYS
Storage
-20C
Provider Type Product Number
- No reagents -