HPA014641

TNFAIP1 antibody from MilliporeSigma / Merck KGaA
B12, B61, BTBD34, EDP1, MGC2317
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014641
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014641, RRID:AB_1858159
Product name
Anti-TNFAIP1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014641
Antibody type
Polyclonal
Antigen
BTB/POZ domain-containing protein TNFAIP1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQA
SPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQS
THRD
Storage
-20C
Provider Type Product Number
- No reagents -