HPA014641

TNFAIP1 antibody from Atlas Antibodies
B12, B61, BTBD34, EDP1, MGC2317
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014641
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014641, RRID:AB_1235969
Product name
Anti-TNFAIP1
Provider product page
Atlas Antibodies - HPA014641
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQA
SPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQS
THRD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -