Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009927-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009927-M01, RRID:AB_714775
- Product name
- MFN2 monoclonal antibody (M01), clone 6A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MFN2.
- Antigen sequence
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGT
FAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSK
AKLLRNKAGWLDSELNMFTHQYLQPSR- Isotype
- IgG
- Antibody clone number
- 6A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mitochondrial and metabolic dysfunction in renal convoluted tubules of obese mice: protective role of melatonin.
Stacchiotti A, Favero G, Giugno L, Lavazza A, Reiter RJ, Rodella LF, Rezzani R
PloS one 2014;9(10):e111141
PloS one 2014;9(10):e111141
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MFN2 monoclonal antibody (M01), clone 6A8. Western Blot analysis of MFN2 expression in PC-12(Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MFN2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol