Antibody data
- Antibody Data
- Antigen structure
- References [8]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009927-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009927-M03, RRID:AB_530127
- Product name
- MFN2 monoclonal antibody (M03), clone 4H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MFN2.
- Antigen sequence
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGT
FAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSK
AKLLRNKAGWLDSELNMFTHQYLQPSR- Isotype
- IgG
- Antibody clone number
- 4H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Twenty-eight days of exposure to 3454 m increases mitochondrial volume density in human skeletal muscle.
The Upshot of LRRK2 Inhibition to Parkinson's Disease Paradigm.
Exercise training can induce cardiac autophagy at end-stage chronic conditions: insights from a graft-versus-host-disease mouse model.
Over-expressing mitofusin-2 in healthy mature mammalian skeletal muscle does not alter mitochondrial bioenergetics.
Regulation of miRNAs in human skeletal muscle following acute endurance exercise and short-term endurance training.
Mitofusin-2 independent juxtaposition of endoplasmic reticulum and mitochondria: an ultrastructural study.
Mitochondrial bioenergetics and dynamics interplay in complex I-deficient fibroblasts.
PGC-1alpha's relationship with skeletal muscle palmitate oxidation is not present with obesity despite maintained PGC-1alpha and PGC-1beta protein.
Jacobs RA, Lundby AK, Fenk S, Gehrig S, Siebenmann C, Flück D, Kirk N, Hilty MP, Lundby C
The Journal of physiology 2016 Mar 1;594(5):1151-66
The Journal of physiology 2016 Mar 1;594(5):1151-66
The Upshot of LRRK2 Inhibition to Parkinson's Disease Paradigm.
Esteves AR, G-Fernandes M, Santos D, Januário C, Cardoso SM
Molecular neurobiology 2015 Dec;52(3):1804-20
Molecular neurobiology 2015 Dec;52(3):1804-20
Exercise training can induce cardiac autophagy at end-stage chronic conditions: insights from a graft-versus-host-disease mouse model.
Fiuza-Luces C, Delmiro A, Soares-Miranda L, González-Murillo Á, Martínez-Palacios J, Ramírez M, Lucia A, Morán M
Brain, behavior, and immunity 2014 Jul;39:56-60
Brain, behavior, and immunity 2014 Jul;39:56-60
Over-expressing mitofusin-2 in healthy mature mammalian skeletal muscle does not alter mitochondrial bioenergetics.
Lally JS, Herbst EA, Matravadia S, Maher AC, Perry CG, Ventura-Clapier R, Holloway GP
PloS one 2013;8(1):e55660
PloS one 2013;8(1):e55660
Regulation of miRNAs in human skeletal muscle following acute endurance exercise and short-term endurance training.
Russell AP, Lamon S, Boon H, Wada S, Güller I, Brown EL, Chibalin AV, Zierath JR, Snow RJ, Stepto N, Wadley GD, Akimoto T
The Journal of physiology 2013 Sep 15;591(18):4637-53
The Journal of physiology 2013 Sep 15;591(18):4637-53
Mitofusin-2 independent juxtaposition of endoplasmic reticulum and mitochondria: an ultrastructural study.
Cosson P, Marchetti A, Ravazzola M, Orci L
PloS one 2012;7(9):e46293
PloS one 2012;7(9):e46293
Mitochondrial bioenergetics and dynamics interplay in complex I-deficient fibroblasts.
Morán M, Rivera H, Sánchez-Aragó M, Blázquez A, Merinero B, Ugalde C, Arenas J, Cuezva JM, Martín MA
Biochimica et biophysica acta 2010 May;1802(5):443-53
Biochimica et biophysica acta 2010 May;1802(5):443-53
PGC-1alpha's relationship with skeletal muscle palmitate oxidation is not present with obesity despite maintained PGC-1alpha and PGC-1beta protein.
Holloway GP, Perry CG, Thrush AB, Heigenhauser GJ, Dyck DJ, Bonen A, Spriet LL
American journal of physiology. Endocrinology and metabolism 2008 Jun;294(6):E1060-9
American journal of physiology. Endocrinology and metabolism 2008 Jun;294(6):E1060-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03), clone 4H8.Lane 1: MFN2 transfected lysate(86.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MFN2 monoclonal antibody (M03), clone 4H8. Western Blot analysis of MFN2 expression in PC-12 ( Cat # L012V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MFN2 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MFN2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol