H00009927-A01

MFN2 antibody from Abnova Corporation
CMT2A2, CPRP1, KIAA0214, MARF
No application information provided.

Antibody data

Product number
H00009927-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009927-A01, RRID:AB_1204675
Product name
MFN2 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00009927-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant MFN2.
Antigen sequence
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGT
FAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSK
AKLLRNKAGWLDSELNMFTHQYLQPSR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -