H00009927-M03J

MFN2 antibody from Abnova Corporation
CMT2A2, CPRP1, KIAA0214, MARF

Antibody data

Product number
H00009927-M03J
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009927-M03J, RRID:AB_1237783
Product name
MFN2 monoclonal antibody (M03J), clone 4H8
Provider product page
Abnova Corporation - H00009927-M03J
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant MFN2.
Antigen sequence
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGT
FAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSK
AKLLRNKAGWLDSELNMFTHQYLQPSR
Isotype
IgG
Antibody clone number
4H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -