Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009927-M03J - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009927-M03J, RRID:AB_1237783
- Product name
- MFN2 monoclonal antibody (M03J), clone 4H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MFN2.
- Antigen sequence
FKRQFVEHASEKLQLVISYTGSNCSHQVQQELSGT
FAHLCQQVDVTRENLEQEIAAMNKKIEVLDSLQSK
AKLLRNKAGWLDSELNMFTHQYLQPSR- Isotype
- IgG
- Antibody clone number
- 4H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Homozygous mutations in MFN2 cause multiple symmetric lipomatosis associated with neuropathy.
Sawyer SL, Cheuk-Him Ng A, Innes AM, Wagner JD, Dyment DA, Tetreault M, Care4Rare Canada Consortium, Majewski J, Boycott KM, Screaton RA, Nicholson G
Human molecular genetics 2015 Sep 15;24(18):5109-14
Human molecular genetics 2015 Sep 15;24(18):5109-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MFN2 expression in transfected 293T cell line by MFN2 monoclonal antibody (M03A), clone 4H8.Lane 1: MFN2 transfected lysate(86.4 KDa).Lane 2: Non-transfected lysate.